accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (361)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (2)
  • (2)
  • (26)
  • (1)
  • (1)
  • (1)
  • (170)
  • (1)
  • (1)
  • (133)
  • (4)
  • (13)

special interests

  • (1)
  • (5)

Applications

  • (13)
  • (13)
  • (13)
  • (1)

Classification

  • (12)
  • (1)
  • (1)

Conjugate

  • (2)
  • (2)
  • (2)
  • (2)
  • (2)
  • (2)
  • (2)

Host Species

  • (13)
  • (1)

Isotype

  • (1)
  • (1)
  • (12)

Quantity

  • (12)
  • (1)
  • (1)

Regulatory Status

  • (14)

Target Species

  • (14)

Form

  • (1)
  • (12)

Search Within Results
Keyword Search:
1 – 15 of 361 results
8

FGFR2 Antibody [Alexa Fluor™ Plus 680] - Humanized, (Research Grade bemarituzumab Biosimilar), R&D Systems™

A Novus product, part of R&D Systems. Human Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human
Host Species Human
Conjugate Alexa Fluor Plus 680
Applications Flow Cytometry,ELISA,Functional Assay
Form Purified
Isotype IgG1
Research Discipline Angiogenesis, Protein Kinase
Antigen FGFR2
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
Product Type Antibody
Gene ID (Entrez) 2263
Formulation 50mM Sodium Borate
Classification Monoclonal
Immunogen FGFR2/ CD332
Primary or Secondary Primary
9

FGFR2 Antibody [Alexa Fluor™ Plus 647] - Humanized, (Research Grade bemarituzumab Biosimilar), R&D Systems™

A Novus product, part of R&D Systems. Human Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human
Host Species Human
Conjugate Alexa Fluor Plus 647
Applications Flow Cytometry,ELISA,Functional Assay
Form Purified
Isotype IgG1
Research Discipline Angiogenesis, Protein Kinase
Antigen FGFR2
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
Product Type Antibody
Gene ID (Entrez) 2263
Formulation 50mM Sodium Borate
Classification Monoclonal
Immunogen FGFR2/ CD332
Primary or Secondary Primary
10

FGFR2 Antibody [Alexa Fluor™ Plus 488] - Humanized, (Research Grade bemarituzumab Biosimilar), R&D Systems™

A Novus product, part of R&D Systems. Human Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human
Host Species Human
Conjugate Alexa Fluor Plus 488
Applications Flow Cytometry,ELISA,Functional Assay
Form Purified
Isotype IgG1
Research Discipline Angiogenesis, Protein Kinase
Antigen FGFR2
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
Product Type Antibody
Gene ID (Entrez) 2263
Formulation 50mM Sodium Borate
Classification Monoclonal
Immunogen FGFR2/ CD332
Primary or Secondary Primary
11

FGFR2 Antibody [Alexa Fluor™ Plus 594] - Humanized, (Research Grade bemarituzumab Biosimilar), R&D Systems™

A Novus product, part of R&D Systems. Human Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human
Host Species Human
Conjugate Alexa Fluor Plus 594
Applications Flow Cytometry,ELISA,Functional Assay
Form Purified
Isotype IgG1
Research Discipline Angiogenesis, Protein Kinase
Antigen FGFR2
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
Product Type Antibody
Gene ID (Entrez) 2263
Formulation 50mM Sodium Borate
Classification Monoclonal
Immunogen FGFR2/ CD332
Primary or Secondary Primary
12

FGFR2 Antibody [Alexa Fluor™ Plus 555] - Humanized, (Research Grade bemarituzumab Biosimilar), R&D Systems™

A Novus product, part of R&D Systems. Human Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human
Host Species Human
Conjugate Alexa Fluor Plus 555
Applications Flow Cytometry,ELISA,Functional Assay
Form Purified
Isotype IgG1
Research Discipline Angiogenesis, Protein Kinase
Antigen FGFR2
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
Product Type Antibody
Gene ID (Entrez) 2263
Formulation 50mM Sodium Borate
Classification Monoclonal
Immunogen FGFR2/ CD332
Primary or Secondary Primary
13

Invitrogen™ CD123/CD3 (Mipletamig Biosimilar) Recombinant Human Monoclonal Antibody
GREENER_CHOICE

Human Recombinant Monoclonal Antibody

ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Human
Conjugate Unconjugated
Applications ELISA,Flow Cytometry,Functional Assay
Form Liquid
Isotype Ig Mix
Concentration 1.84 mg/mL
Antigen CD123/CD3 (Mipletamig Biosimilar)
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias lab-variant antibody; Miple-tam
Product Type Antibody
Formulation PBS with no preservative; pH 7.4
Classification Recombinant Monoclonal
Primary or Secondary Primary
14

BNIPL Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_612122
Research Discipline Cytokine Research
Concentration 0.5 mg/ml
Antigen BNIPL
Gene Symbols BNIPL
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1.0 ug/ml
Molecular Weight of Antigen 40 kDa
Gene Alias bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein, BCL2/adenovirus E1B 19kD interacting protein like, BNIP-2 similar, BNIPl-1, BNIPL-2, BNIP-S, PP753
Product Type Antibody
Gene ID (Entrez) 149428
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Classification Polyclonal
Immunogen Synthetic peptide directed towards the middle region of human BNIPLThe immunogen for this antibody is BNIPL. Peptide sequence AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Primary or Secondary Primary
15

Jackson Immuno Research Labs JACKSON IMMUNO RESEARCH LABS

NC3935720 GOAT ANTI-MOUSE IGM 1MG

ENCOMPASS_PREFERRED