accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (160,081)
Primary Antibody Matched Pairs (708)
Protein Interaction Antibody Pairs (3)
Protein Phosphorylation Antibody Pairs (1)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (4)

brands

  • (2)
  • (5)
  • (1,090)
  • (123)
  • (1,282)
  • (13)
  • (1)
  • (223)
  • (1)
  • (2)
  • (4)
  • (1)
  • (1)
  • (3)
  • (2)
  • (6)
  • (27,779)
  • (3)
  • (51)
  • (37)
  • (1)
  • (3)
  • (1)
  • (54)
  • (144)
  • (211)
  • (5)
  • (36)
  • (2)
  • (62)
  • (2)
  • (1)
  • (192)
  • (85)
  • (1)
  • (8)
  • (2)
  • (2)
  • (1)
  • (1)
  • (1)
  • (3)
  • (2)
  • (8)
  • (1)
  • (1)
  • (14)
  • (7)
  • (2)
  • (1)
  • (102)
  • (167)
  • (40)
  • (5)
  • (1)
  • (5)
  • (2)
  • (4)
  • (1)
  • (2,239)
  • (13)
  • (18)
  • (8)
  • (238)
  • (7)
  • (1)
  • (798)
  • (2)
  • (1)
  • (2)
  • (3)
  • (1)
  • (5)
  • (3)
  • (3)
  • (1)
  • (2,633)
  • (6)
  • (1)
  • (122,033)
  • (2)
  • (6)
  • (24)
  • (2)
  • (5)
  • (89)
  • (675)
  • (74)
  • (8)
  • (2)
  • (1)
  • (1)
  • (9)
  • (10)
  • (1)

special interests

  • (62)
  • (106)
  • (31,887)
  • (2)
  • (476)

Quantity

  • (1)
  • (115)
  • (27)
  • (117)
  • (680)
  • (50)
  • (379)
Show all

Conjugate

  • (1,578)
  • (1)
  • (145)
  • (65)
  • (85)
  • (1)
  • (1,989)
Show all

Host Species

  • (13)
  • (278)
  • (54)
  • (53)
  • (7)
  • (2)
  • (2)
Show all

Regulatory Status

  • (158,206)

Target Species

  • (5)
  • (78)
  • (25)
  • (14)
  • (14)
  • (7)
  • (4)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (89)
  • (1)
  • (1)
  • (1)
Show all

Applications

  • (15)
  • (17)
  • (28)
  • (267)
  • (3)
  • (3)
  • (110)
Show all

Classification

  • (107,777)
  • (5)
  • (47,791)
  • (463)
  • (5)

Form

  • (176)
  • (292)
  • (12)
  • (63,480)
  • (2,112)
  • (3)
  • (46,899)
Show all

Research Discipline

  • (1)
  • (1)
  • (2)

Search Within Results
Keyword Search:
1 – 15 of 147,062 results
1

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen Solute carrier family 22 member 18
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 5002
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGLVIGQLSSHFSEEVLLR
Primary or Secondary Primary
2

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen Solute carrier family 22 member 18
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 5002
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
Primary or Secondary Primary
3

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Concentration 0.5 mg/ml
Antigen Solute carrier family 22 member 18
Gene Symbols SLC22A18
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1.0 ug/ml
Gene Alias BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Product Type Antibody
Gene ID (Entrez) 5002
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Classification Polyclonal
Immunogen Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Primary or Secondary Primary
Test Specificity Expected identity based on immunogen sequence: Guinea pig: 92%; Equine: 92%; Bovine: 85%; Mouse: 85%.
4

solute carrier family 22, member 18 antisense Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype IgG
Antigen solute carrier family 22, member 18 antisense
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 5003
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
Primary or Secondary Primary
5

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Concentration 0.5 mg/ml
Antigen Solute carrier family 22 member 18
Gene Symbols SLC22A18
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1.0 ug/ml
Gene Alias BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Product Type Antibody
Gene ID (Entrez) 5002
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Classification Polyclonal
Immunogen Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the middle region of SLC22A18. Peptide sequence IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Primary or Secondary Primary
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
6

Solute carrier family 22 member 18 Antibody - BSA Free, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

7

solute carrier family 22, member 18 antisense Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype IgG
Concentration 0.75mg/mL
Antigen solute carrier family 22, member 18 antisense
Gene Symbols SLC22A18AS
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 1:500-1:3000, Immunohistochemistry 10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:1000, Immunohistochemistry-Paraffin 1:100-1:1000
Gene Alias BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein
Product Type Antibody
Gene ID (Entrez) 5003
Formulation 0.1M Tris (pH 7.0), 0.1M Glycine and 20% Glycerol with 0.01% Thimerosal
Classification Polyclonal
Immunogen Recombinant protein encompassing a sequence within the center region of human SLC22A18AS. The exact sequence is proprietary.
Primary or Secondary Primary
8

solute carrier family 26, member 9, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC26A9.

9

solute carrier family 45, member 2, Mouse, Clone: 1B2, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant SLC45A2.

10

solute carrier family 26, member 6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC26A6.

11

solute carrier family 26, member 4, Mouse, Clone: 3D2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SLC26A4.

14

solute carrier family 38, member 3, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SLC38A3 protein.