accessibility menu, dialog, popup

UserName
Viewing profile as user:

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (45,167)
Secondary Antibodies (3,596)
Isotype Controls and Standards (340)
Antibody Panels and Kits (84)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)

brands

  • (19)
  • (1,085)
  • (1,078)
  • (1)
  • (627)
  • (14)
  • (18)
  • (71)
  • (1)
  • (2)
  • (1)
  • (264)
  • (10)
  • (1)
  • (6)
  • (4)
  • (15,451)
  • (3)
  • (1)
  • (20)
  • (94)
  • (5)
  • (162)
  • (1)
  • (33)
  • (2)
  • (51)
  • (190)
  • (6,896)
  • (5)
  • (20)
  • (1)
  • (8)
  • (457)
  • (1)
  • (270)
  • (1)
  • (13)
  • (1)
  • (1)
  • (3)
  • (2)
  • (50)
  • (12)
  • (1)
  • (11)
  • (3)
  • (21)
  • (22)
  • (2)
  • (43)
  • (1)
  • (215)
  • (27)
  • (21)
  • (4)
  • (6)
  • (169)
  • (180)
  • (4)
  • (29)
  • (3,311)
  • (1)
  • (129)
  • (153)
  • (64)
  • (1)
  • (1)
  • (7)
  • (215)
  • (2)
  • (17)
  • (327)
  • (52)
  • (1)
  • (1)
  • (133)
  • (1,100)
  • (11)
  • (15,572)
  • (39)
  • (6)
  • (3)
  • (2)
  • (84)
  • (1)
  • (16)
  • (34)
  • (30)
  • (1)
  • (44)
  • (1)
  • (12)
  • (1)
  • (2)
  • (48)
  • (1)

special interests

  • (171)
  • (3,084)
  • (1,774)

Quantity

  • (3)
  • (1)
  • (10)
  • (254)
  • (71)
  • (100)
  • (55)
Show all

Regulatory Status

  • (3)
  • (18)
  • (37,979)

Conjugate

  • (429)
  • (115)
  • (11)
  • (39)
  • (533)
  • (435)
  • (621)
Show all

Applications

  • (5)
  • (1)
  • (23)
  • (3)
  • (4)
  • (6)
  • (14)
Show all

Host Species

  • (6)
  • (232)
  • (52)
  • (15)
  • (1,197)
  • (5)
  • (355)
Show all

Target Species

  • (12)
  • (37)
  • (2)
  • (3)
  • (57)
  • (8)
  • (39)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (31)
  • (1)
  • (1)
  • (1)
Show all

Classification

  • (5)
  • (29,807)
  • (1)
  • (5,371)
  • (749)
  • (1)
  • (10)

Form

  • (24)
  • (67)
  • (16)
  • (13,417)
  • (512)
  • (7)
  • (14,309)
Show all

Research Discipline

  • (1)

Search Within Results
Keyword Search:
1 – 15 of 46,746 results
1

MilliporeSigma™ anti-Tissue Factor Clone: TF9-10H10,

Mouse Monoclonal Antibody

Antigen Tissue Factor
Regulatory Status RUO
Content And Storage −20°C
Host Species Mouse
Applications Dot Blot,ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunofluorescence,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin)
Form Purified
Formulation Lyophilized from 200mM mannitol, 150mM PBS, pH 7.4.
Immunogen purified apoprotein of human tissue factor
Classification Monoclonal
Isotype IgG1
Primary or Secondary Primary
Clone TF9-10H10
Test Specificity Recognizes the tissue factor protein.
2

MilliporeSigma™ anti-Tissue Plasminogen Activator Clone: GMA-043,

Mouse Monoclonal Antibody

Antigen Tissue Plasminogen Activator
Regulatory Status RUO
Content And Storage −20°C
Host Species Mouse
Applications ELISA,Immunoblot,Immunoblot
Form Purified
Formulation In 150mM NaCl, 10mM sodium phosphate, 1% mannitol, pH 7.4.
Immunogen purified human tissue plasminogen activator (tPA)
Classification Monoclonal
Isotype IgG1
Primary or Secondary Primary
Clone GMA-043
Test Specificity Recognizes the ∽60kDa tPA protein.
3

Tissue alpha-L-Fucosidase/FUCA1 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG
Gene Accession No. P04066
Research Discipline Signal Transduction
Antigen Tissue alpha-L-Fucosidase/FUCA1
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution ELISA 1:5000-1:10000
Gene Alias Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase
Product Type Antibody
Gene ID (Entrez) 2517
Formulation 0.2um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Human Tissue alpha-L-Fucosidase/FUCA1 (Gln32-Lys466; Uniprot: P04066)
Classification Polyclonal
Primary or Secondary Primary
4

Tissue alpha-L-Fucosidase/FUCA1 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunoprecipitation,Western Blot
Form Purified
Isotype IgG
Research Discipline Signal Transduction
Antigen Tissue alpha-L-Fucosidase/FUCA1
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:1000, ELISA 1:25000-1:50000, Immunoprecipitation 1-2 uL/mg of lysate
Gene Alias Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase
Product Type Antibody
Gene ID (Entrez) 2517
Formulation 0.2 um filtered solution in PBS
Classification Polyclonal
Immunogen Produced in rabbits immunized with purified, recombinant Human Tissue alpha-L-Fucosidase/FUCA1 (Accession#: P04066; Gln32-Lys466)
Primary or Secondary Primary
5

Coagulation Factor III/Tissue Factor Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunocytochemistry,Immunofluorescence,Western Blot
Isotype IgG
Antigen Coagulation Factor III/Tissue Factor
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 2152
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV
Primary or Secondary Primary
6

Alkaline Phosphatase, Tissue Non-Specific Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Cancer, Lipid and Metabolism, Ovarian Carcinoma Cell Markers, Phospho Specific, Protein Phosphatase, Stem Cell Markers
Antigen Alkaline Phosphatase, Tissue Non-Specific
Regulatory Status RUO
Purification Method Immunogen affinity purified
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias Alkaline phosphatase liver/bone/kidney isozyme, alkaline phosphatase, liver/bone/kidney, alkaline phosphatase, tissue-nonspecific isozyme, alkaline phosphomonoesterase, APTNAP, AP-TNAP, EC 3.1.3.1, FLJ40094, FLJ93059, glycerophosphatase, HOPS, liver/bone/kidney-type alkaline phosphatase, MGC161443, tissue-nonspecific ALP, TNAP, TNSALPMGC167935
Product Type Antibody
Gene ID (Entrez) 249
Formulation PBS (pH 7.2) and 40% Glycerol
Classification Polyclonal
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVA
Primary or Secondary Primary
7

Tissue alpha-L-Fucosidase/FUCA1 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen Tissue alpha-L-Fucosidase/FUCA1
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 2517
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIK
Primary or Secondary Primary
8

Tissue alpha-L-Fucosidase/FUCA1 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype IgG
Antigen Tissue alpha-L-Fucosidase/FUCA1
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 2517
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWL
Primary or Secondary Primary
9

Tissue alpha-L-Fucosidase/FUCA1 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. P04066
Research Discipline Signal Transduction
Concentration 0.5 mg/ml
Antigen Tissue alpha-L-Fucosidase/FUCA1
Gene Symbols FUCA1
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1.0 ug/ml
Gene Alias Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase
Product Type Antibody
Gene ID (Entrez) 2517
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Classification Polyclonal
Immunogen Synthetic peptides corresponding to FUCA1(fucosidase, alpha-L- 1, tissue) The peptide sequence was selected from the middle region of FUCA1. Peptide sequence TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Primary or Secondary Primary
Test Specificity Expected identity based on immunogen sequence: Chicken: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Xenopus: 85%; Rabbit: 85%.
10

Coagulation Factor III/Tissue Factor Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Antigen Coagulation Factor III/Tissue Factor
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 2152
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN
Primary or Secondary Primary
11

Alkaline Phosphatase, Tissue Non-Specific Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen Alkaline Phosphatase, Tissue Non-Specific
Gene Symbols ALPL
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias Alkaline phosphatase liver/bone/kidney isozyme, alkaline phosphatase, liver/bone/kidney, alkaline phosphatase, tissue-nonspecific isozyme, alkaline phosphomonoesterase, APTNAP, AP-TNAP, EC 3.1.3.1, FLJ40094, FLJ93059, glycerophosphatase, HOPS, liver/bone/kidney-type alkaline phosphatase, MGC161443, tissue-nonspecific ALP, TNAP, TNSALPMGC167935
Product Type Antibody
Gene ID (Entrez) 249
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Classification Polyclonal
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANL
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
12

Mouse Coagulation Factor III/Tissue Factor Antibody, R&D Systems™
GREENER_CHOICE

Rat Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Mouse
Host Species Rat
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG2c
Gene Accession No. P20352
Concentration LYOPH
Antigen Coagulation Factor III/Tissue Factor
Gene Symbols F3
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Western Blot 1 ug/mL
Gene Alias CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), F3, FLJ17960, TF, TFA, Thromboplastin, tissue factor
Product Type Antibody
Gene ID (Entrez) 2152
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen Mouse myeloma cell line NS0-derived recombinant mouse Coagulation Factor III Ala29-Glu251 Accession # P20352
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects mouse Coagulation Factor III/Tissue Factor in direct ELISAs and Western blots.
Clone 355220
13

Human Coagulation Factor III/ Tissue Factor Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody has been used in 5 publications

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Human
Host Species Goat
Conjugate Unconjugated
Applications CyTOF,Electron Microscopy,ELISA Capture (Matched Antibody Pair),ELISA Development,Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Isotype IgG
Gene Accession No. P13726
Concentration LYOPH
Antigen Coagulation Factor III/Tissue Factor
Gene Symbols F3
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.5 ug/mL, Flow Cytometry 2.5 ug/10^6 cells, Immunohistochemistry 5-15 ug/mL, Immunoprecipitation 25 ug/mL, CyTOF-ready
Gene Alias CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), F3, FLJ17960, TF, TFA, Thromboplastin, tissue factor
Product Type Antibody
Gene ID (Entrez) 2152
Immunogen Mouse myeloma cell line NS0-derived recombinant human Coagulation Factor III/Tissue Factor Gly34-Glu251 Accession # P13726
Classification Polyclonal
Reconstitution Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects human Coagulation Factor III/Tissue Factor in direct ELISAs and Western blots. In direct ELISAs, less than 5% cross-reactivity with recombinant mouse Coagulation Factor III/Tissue Factor is observed.
14

Mouse Coagulation Factor III/Tissue Factor Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody has been used in 5 publications

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Mouse,Transgenic Mouse
Host Species Goat
Conjugate Unconjugated
Applications CyTOF,ELISA Detection (Matched Antibody Pair),FACS,Flow Cytometry,Immunocytochemistry,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunoprecipitation,Neutralization,Western Blot
Isotype IgG
Gene Accession No. P20352
Concentration LYOPH
Antigen Coagulation Factor III/Tissue Factor
Gene Symbols F3
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.1 ug/mL, Flow Cytometry 2.5 ug/10^6 cells, Immunoprecipitation 25 ug/mL, CyTOF-ready
Gene Alias CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), F3, FLJ17960, TF, TFA, Thromboplastin, tissue factor
Product Type Antibody
Gene ID (Entrez) 2152
Immunogen Mouse myeloma cell line NS0-derived recombinant mouse Coagulation Factor III/Tissue Factor Ala29-Glu251 Accession # P20352
Classification Polyclonal
Reconstitution Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects mouse Coagulation Factor III in direct ELISAs and Western blots.
15

Alkaline Phosphatase, Tissue Non-Specific Antibody (V17.1), R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Content And Storage Store at 4C.
Conjugate Unconjugated
Target Species Bovine,Human
Host Species Mouse
Applications Flow Cytometry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG1 κ
Antigen Alkaline Phosphatase, Tissue Non-Specific
Regulatory Status RUO
Purification Method Protein A or G purified
Gene Alias Alkaline phosphatase liver/bone/kidney isozyme, alkaline phosphatase, liver/bone/kidney, alkaline phosphatase, tissue-nonspecific isozyme, alkaline phosphomonoesterase, APTNAP, AP-TNAP, EC 3.1.3.1, FLJ40094, FLJ93059, glycerophosphatase, HOPS, liver/bone/kidney-type alkaline phosphatase, MGC161443, tissue-nonspecific ALP, TNAP, TNSALPMGC167935
Formulation 10mM PBS and 0.05% BSA with 0.05% Sodium Azide
Gene ID (Entrez) 249
Classification Monoclonal
Immunogen Bovine intestinal alkaline phosphatase
Primary or Secondary Primary
Clone V17.1