accessibility menu, dialog, popup

UserName
Viewing profile as user:

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (177)
Secondary Antibodies (2)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (2)
  • (1)
  • (2)
  • (1)
  • (2)
  • (2)
  • (10)
  • (2)
  • (1)
  • (2)
  • (2)
  • (152)

special interests

  • (13)
  • (4)

Applications

  • (37)
  • (2)
  • (7)
  • (2)
  • (1)
  • (122)
  • (41)
Show all

Classification

  • (82)
  • (89)

Conjugate

  • (4)
  • (4)
  • (4)
  • (4)
  • (4)
  • (4)
  • (4)
Show all

Host Species

  • (1)
  • (39)
  • (81)
  • (50)

Quantity

  • (1)
  • (90)
  • (1)
  • (2)
  • (21)
  • (1)
  • (8)
Show all

Regulatory Status

  • (171)

Target Species

  • (2)
  • (162)
  • (80)
  • (2)
  • (50)
  • (2)

Isotype

  • (2)
  • (84)
  • (1)
  • (38)
  • (1)
  • (38)
  • (2)
Show all

Form

  • (21)
  • (2)
  • (132)

Search Within Results
Keyword Search:
1 – 15 of 176 results
1

CART/CARTPT Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Gene Symbols CARTPT
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Classification Polyclonal
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSF
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
2

CART/CARTPT Antibody [Allophycocyanin], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate APC
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation PBS
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
3

CART/CARTPT Antibody [HRP], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate HRP
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation PBS
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
4

CART/CARTPT Antibody (C1), R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

5

Human CART Biotinylated Antibody, R&D Systems™
GREENER_CHOICE

Goat Polyclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Human,Rat
Host Species Goat
Conjugate Biotin
Applications Immunohistochemistry,Western Blot
Isotype IgG
Gene Accession No. Q16568
Concentration LYOPH
Antigen CART/CARTPT
Gene Symbols CARTPT
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.1 ug/mL, Immunohistochemistry 5-15 ug/mL
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, CARTPT, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Immunogen E. coli-derived recombinant human CART Gln28-Leu116 Accession # Q16568
Classification Polyclonal
Reconstitution Reconstitute at 0.2 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects human CART in Western blots.
6

CART/CARTPT Antibody [FITC], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate FITC
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation PBS
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
7

CART/CARTPT Antibody [PE], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate PE
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation PBS
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
8

CART/CARTPT Antibody [PerCP], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate PerCP
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation PBS
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
9

CART/CARTPT Antibody (C7), R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

10

CART/CARTPT Antibody (113612) [Allophycocyanin], R&D Systems™

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human
Host Species Mouse
Conjugate APC
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG2b
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Protein A or G purified from ascites
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation PBS
Classification Monoclonal
Immunogen E. coli-derived recombinant human CART, Ala37-Leu116, Accession # Q16568
Primary or Secondary Primary
Clone 113612
11

CART/CARTPT Antibody [DyLight 755], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate DyLight 755
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation 50mM Sodium Borate
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
12

CART/CARTPT Antibody [DyLight 488], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate DyLight 488
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation 50mM Sodium Borate
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
13

CART/CARTPT Antibody [DyLight 550], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate DyLight 550
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation 50mM Sodium Borate
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
14

CART/CARTPT Antibody [DyLight 680], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate DyLight 680
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation 50mM Sodium Borate
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary
15

CART/CARTPT Antibody [DyLight 650], R&D Systems™

A Novus product, part of R&D Systems. Goat Polyclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse,Rat
Host Species Goat
Conjugate DyLight 650
Applications Immunohistochemistry,Western Blot
Form Purified
Isotype IgG
Research Discipline Neuroscience
Antigen CART/CARTPT
Regulatory Status RUO
Purification Method Antigen Affinity-purified
Gene Alias CART prepropeptide, CARTcocaine and amphetamine regulated transcript, cocaine- and amphetamine-regulated transcript protein
Product Type Antibody
Gene ID (Entrez) 9607
Formulation 50mM Sodium Borate
Classification Polyclonal
Immunogen E. coli-derived recombinant human CART, Gln28-Leu116, Accession # Q16568
Primary or Secondary Primary