Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.

Search Within Results

1 – 15 of 150,538 results

Promotions Available

Invitrogen™ Secondary Antibody Solution Alk-Phos. Conjugated (Anti-Rabbit)

Pre-diluted, ready-to-use formulation containing alkaline phosphatase labeled polyclonal antibodies in a proprietary stabilizing reagent.

Pricing & Availability
Specifications

Target Species	Rabbit
Host Species	Goat
Conjugate	Alkaline Phosphatase (AP)
Classification	Polyclonal
Isotype	IgG

Promotions Available

Invitrogen™ Secondary Antibody Solution Alk-Phos. Conjugated (Anti-Mouse)

Pre-diluted, ready-to-use formulation containing alkaline phosphatase labeled polyclonal antibodies in a proprietary stabilizing reagent.

Pricing & Availability
Specifications

Target Species	Mouse
Host Species	Goat
Conjugate	Alkaline Phosphatase (AP)
Classification	Polyclonal
Isotype	IgG

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Concentration	0.5 mg/ml
Antigen	Solute carrier family 22 member 18
Gene Symbols	SLC22A18
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1.0 ug/ml
Gene Alias	BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Product Type	Antibody
Gene ID (Entrez)	5002
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Classification	Polyclonal
Immunogen	Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG.
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Primary or Secondary	Primary
Test Specificity	Expected identity based on immunogen sequence: Guinea pig: 92%; Equine: 92%; Bovine: 85%; Mouse: 85%.

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human
Host Species	Rabbit
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype	IgG
Antigen	Solute carrier family 22 member 18
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	5002
Classification	Polyclonal
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
Primary or Secondary	Primary

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human
Host Species	Rabbit
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype	IgG
Antigen	Solute carrier family 22 member 18
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	5002
Classification	Polyclonal
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGLVIGQLSSHFSEEVLLR
Primary or Secondary	Primary

solute carrier family 22, member 18 antisense Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human
Host Species	Rabbit
Applications	Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype	IgG
Antigen	solute carrier family 22, member 18 antisense
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	5003
Classification	Polyclonal
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
Primary or Secondary	Primary

Solute carrier family 22 member 18 Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Isotype	IgG
Concentration	0.5 mg/ml
Antigen	Solute carrier family 22 member 18
Gene Symbols	SLC22A18
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1.0 ug/ml
Gene Alias	BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Product Type	Antibody
Gene ID (Entrez)	5002
Formulation	PBS, 2% Sucrose with 0.09% Sodium Azide
Classification	Polyclonal
Immunogen	Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the middle region of SLC22A18. Peptide sequence IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK.
Reconstitution	Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Primary or Secondary	Primary
Test Specificity	Expected identity based on immunogen sequence: Human: 100%.

solute carrier family 22, member 18 antisense Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry/Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Isotype	IgG
Concentration	0.75mg/mL
Antigen	solute carrier family 22, member 18 antisense
Gene Symbols	SLC22A18AS
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1:500-1:3000, Immunohistochemistry 10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:1000, Immunohistochemistry-Paraffin 1:100-1:1000
Gene Alias	BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein
Product Type	Antibody
Gene ID (Entrez)	5003
Formulation	0.1M Tris (pH 7.0), 0.1M Glycine and 20% Glycerol with 0.01% Thimerosal
Classification	Polyclonal
Immunogen	Recombinant protein encompassing a sequence within the center region of human SLC22A18AS. The exact sequence is proprietary.
Primary or Secondary	Primary